Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PP2A-Cβ CRISPR/Cas9 KO Plasmid (m2)
sc-422382-KO-2 20 µg

PP2A-Cβ CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212471) Human Recombinant Protein
TP310623M 100 µg

Protein Kinase A reguLatory subunit I alpha (PRKAR1A) (NM_212471) Human Recombinant Protein

Sign In for Pricing
View Details
Kat8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7568505 3x 1.0 µg

Kat8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
KLF15 sgRNA CRISPR Lentivector set (Human)
K1154601 3x 1.0 µg

KLF15 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
USP7 Antibody
KC-3898-01 50 μL

USP7 Antibody

Sign In for Pricing
View Details
USP7 Antibody
KC-3898-02 100 µL

USP7 Antibody

Sign In for Pricing
View Details