Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf14 Human shRNA Lentiviral Particle (Locus ID 26170)
TL319781V 500 µL Each

C19orf14 Human shRNA Lentiviral Particle (Locus ID 26170)

Sign In for Pricing
View Details
PRICKLE2-AS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV741604 1.0 µg DNA

PRICKLE2-AS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Pias4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3744705 3x 1.0 µg

Pias4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal Legionella Pneumophila Lps Antibody (5F4) [DyLight 550]
NB100-73187R 0.2 mL

Mouse Monoclonal Legionella Pneumophila Lps Antibody (5F4) [DyLight 550]

Sign In for Pricing
View Details
YPEL1 Protein Vector (Human) (pPM-C-HA)
PV046727 500 ng

YPEL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human SKAP55 Affinity Purified Polyclonal Ab
AF4264-SP 25 µg

Human SKAP55 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details