Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aurora B (AURKB) (NM_004217) Human Tagged Lenti ORF Clone
RC210288L3 10 µg

Aurora B (AURKB) (NM_004217) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SIRP delta Overexpression Lysate (Denatured) - (Dry Ice)
H00128646-T01 0.1 mL

SIRP delta Overexpression Lysate (Denatured) - (Dry Ice)

Sign In for Pricing
View Details
Torsin B (TOR1B) (NM_014506) Human Over-expression Lysate
LC415210 20 µg

Torsin B (TOR1B) (NM_014506) Human Over-expression Lysate

Sign In for Pricing
View Details
DMRT3 Recombinant Protein (Mouse)
RP129347 100 µg

DMRT3 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CLVS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV687262 1.0 µg DNA

CLVS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral mouse Itfg2 shRNA (UAS) - Lentiviral mouse Itfg2 shRNA (UAS, iRFP) plasmid
GTR15292540 1 Vial

Lentiviral mouse Itfg2 shRNA (UAS) - Lentiviral mouse Itfg2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details