Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRO3P-set siRNA/shRNA/RNAi Lentivector (Human)
48894091 4x 500 ng

TYRO3P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12) (PE) discontinued
A2298-76N-PE 200 µL

ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12) (PE) discontinued

Sign In for Pricing
View Details
Olfr385 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4276606 1.0 µg DNA

Olfr385 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SH-PEG12-OH
MD003002-12 Inquire

SH-PEG12-OH

Sign In for Pricing
View Details
GAD2 siRNA (Rat)
MBS8219222-01 15 nmol

GAD2 siRNA (Rat)

Sign In for Pricing
View Details
GAD2 siRNA (Rat)
MBS8219222-02 30 nmol

GAD2 siRNA (Rat)

Sign In for Pricing
View Details