Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF230 (6Z6) Mouse Monoclonal antibody
E28PE2979 100 µL

ZNF230 (6Z6) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Klk1b8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3978406 1.0 µg DNA

Klk1b8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DLL4 hFc Chimera, Human
Z03955-500 500 µg

DLL4 hFc Chimera, Human

Sign In for Pricing
View Details
CD79a, Antibody
GWB-29A952 1 mL

CD79a, Antibody

Sign In for Pricing
View Details
Lentiviral human PRKAG2 shRNA (UAS) - Lentiviral human PRKAG2 shRNA (UAS) plasmid
GTR15086479 1 Vial

Lentiviral human PRKAG2 shRNA (UAS) - Lentiviral human PRKAG2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Anti-SNX17 antibody
SL39140R-01 50 µL

Rabbit Anti-SNX17 antibody

Sign In for Pricing
View Details