Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF3/LTBR, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Product Specifications

Product Name Alternative

TNFRSF3/LTBR Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf3-protein-human-hek-293-his.html

Purity

98.0

Smiles

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Formula

4055 (Gene_ID) P36941-1 (Q31-M227) (Accession)

Molecular Weight

29-40 kDa

References & Citations

[1]Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.|[2]Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16 (1) :937-942.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS25 Protein Vector (Mouse) (pPM-C-HA)
PV202228 500 ng

MRPS25 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)
GWB-43F409 10 mg

Affinity Purified Anti-HUMAN IgG F(ab )2 (RABBIT)

Sign In for Pricing
View Details
GSK3 alpha/beta Antibody
MBS8512362-01 0.05 mg

GSK3 alpha/beta Antibody

Sign In for Pricing
View Details
GSK3 alpha/beta Antibody
MBS8512362-02 0.1 mg

GSK3 alpha/beta Antibody

Sign In for Pricing
View Details
GSK3 alpha/beta Antibody
MBS8512362-03 0.1 mL (AF750)

GSK3 alpha/beta Antibody

Sign In for Pricing
View Details
GSK3 alpha/beta Antibody
MBS8512362-04 0.1 mL (AF405M)

GSK3 alpha/beta Antibody

Sign In for Pricing
View Details