Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEAD3, Human (His-SUMO)

TEAD3 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD3 Protein, Human (His-SUMO) is the recombinant human-derived TEAD3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

TEAD3 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tead3-protein-human-his-sumo.html

Purity

90.00

Smiles

MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

Molecular Formula

7005 (Gene_ID) Q99594 (M112-D435) (Accession)

Molecular Weight

Approximately 52.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARK1 Human qPCR Template Standard (NM_018650)
HK210707 1 Kit

MARK1 Human qPCR Template Standard (NM_018650)

Sign In for Pricing
View Details
COPG2
CSB-CL866200HU 10 μg Plasmid + 200 μL Glycerol

COPG2

Sign In for Pricing
View Details
CDY2B 3'UTR Lenti-reporter-Luc Vector
15790081 1.0 µg

CDY2B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human MASP1 (Mannan Associated Serine Protease 1) ValidElisa Kit
EK341284 96 Well

Human MASP1 (Mannan Associated Serine Protease 1) ValidElisa Kit

Sign In for Pricing
View Details
PCBP2 Rabbit Monoclonal Antibody
orb1147297 100 µL

PCBP2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV668416 1.0 µg DNA

CSF3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details