Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P-selectin (SELP), partial

Product Specifications

Product Name Alternative

CD62 antigen-like family member P; Granule membrane protein 140; GMP-140; Leukocyte-endothelial cell adhesion molecule 3; LECAM3; Platelet activation dependent granule-external membrane protein; PADGEM; CD62P

Abbreviation

Recombinant Human SELP protein, partial

Gene Name

SELP

UniProt

P16109

Expression Region

42-771aa

Organism

Homo sapiens (Human)

Target Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Tag

C-terminal hFc1-Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Ca2+-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with SELPLG.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

108.8 kDa

References & Citations

"Glycan Bound to the Selectin Low Affinity State Engages Glu-88 to Stabilize the High Affinity State under Force." Mehta-D'souza P., Klopocki A.G., Oganesyan V., Terzyan S., Mather T., Li Z., Panicker S.R., Zhu C., McEver R.P. J. Biol. Chem. 292:2510-2518 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: sigmoid
CS702522 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
ABCA6 Rabbit Polyclonal Antibody
TA367723 100 µL

ABCA6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Mannoheptulose
TRC-M165100-25MG 25 mg

D-Mannoheptulose

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 2 (CYSLTR2) ELISA Kit
RDR-CYSLTR2-Hu-01 96 Tests

Human Cysteinyl Leukotriene Receptor 2 (CYSLTR2) ELISA Kit

Sign In for Pricing
View Details
Human Cysteinyl Leukotriene Receptor 2 (CYSLTR2) ELISA Kit
RDR-CYSLTR2-Hu-02 48 Tests

Human Cysteinyl Leukotriene Receptor 2 (CYSLTR2) ELISA Kit

Sign In for Pricing
View Details
FKBP6 (NM_001135211) Human Over-expression Lysate
LY427592 100 µg

FKBP6 (NM_001135211) Human Over-expression Lysate

Sign In for Pricing
View Details