Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Product Specifications

Product Name Alternative

Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)

Abbreviation

Recombinant Human KLRK1 protein, partial (Active)

Gene Name

KLRK1

UniProt

P26718

Expression Region

78-216aa

Organism

Homo sapiens (Human)

Target Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCTN1 Rabbit Polyclonal Antibody (BF647)
orb2535518 100 µL

TCTN1 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
ECHS1 ELISA Kit (Human) (OKEH05661)
OKEH05661 96 Well

ECHS1 ELISA Kit (Human) (OKEH05661)

Sign In for Pricing
View Details
GPR32 Lentiviral Activation Particles (h2)
sc-405309-LAC-2 200 µL

GPR32 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Lentiviral human OCM2 shRNA (UAS) - Lentiviral human OCM2 shRNA (UAS, RFP) (100)
GTR15309195 1 Vial

Lentiviral human OCM2 shRNA (UAS) - Lentiviral human OCM2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
TNFSF14 Antibody, HRP conjugated
A42087-100UG 100 µg

TNFSF14 Antibody, HRP conjugated

Sign In for Pricing
View Details
C3orf49 Rabbit Polyclonal Antibody (BF405)
orb2372698 100 µL

C3orf49 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details