Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NKG2-D type II integral membrane protein (KLRK1), partial (Active)

Product Specifications

Product Name Alternative

Killer cell lectin-like receptor subfamily K member 1 (NK cell receptor D) (NKG2-D-activating NK receptor) (CD314)

Abbreviation

Recombinant Human KLRK1 protein, partial (Active)

Gene Name

KLRK1

UniProt

P26718

Expression Region

78-216aa

Organism

Homo sapiens (Human)

Target Sequence

FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8+ T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1 (CSB-MP887177HU), the EC50 of human KLRK1 protein is 222.4-276.0 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRTN-set siRNA/shRNA/RNAi Lentivector (Human)
32183091 4x 500 ng

NRTN-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Rex1 (ZFP42) (NM_174900) Human Tagged Lenti ORF Clone
RC223916L4 10 µg

Rex1 (ZFP42) (NM_174900) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MLPH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
30213062 1.0 µg DNA

MLPH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat Ttf1 Pre-designed siRNA Set B
SI215371B 1 Each

Rat Ttf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lrrc71 (NM_028971) Mouse Tagged ORF Clone
MG219413 10 µg

Lrrc71 (NM_028971) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD79b Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-60240R-BF488-01 20 µL

CD79b Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details