Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial (Active)

Product Specifications

Product Name Alternative

PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)

Abbreviation

Recombinant Human CD274 protein, partial (Active)

Gene Name

CD274

UniProt

Q9NZQ7

Expression Region

19-238aa

Organism

Homo sapiens (Human)

Target Sequence

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813417, PubMed:28813410) . As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed:11015443, PubMed:28813417, PubMed:28813410) . Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed:10581077) The PDCD1-mediated inhibitory pathway is exploited by tumors to attenuate anti-tumor immunity and escape destruction by the immune system, thereby facilitating tumor survival (PubMed:28813417, PubMed:28813410) . The interaction with PDCD1/PD-1 inhibits cytotoxic T lymphocytes (CTLs) effector function (By similarity) . The blockage of the PDCD1-mediated pathway results in the reversal of the exhausted T-cell phenotype and the normalization of the anti-tumor response, providing a rationale for cancer immunotherapy (By similarity) .

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody (CSB-MA878942A1m, antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N’-Diacetyl-L-cystine Bis(tert-Butyl) Diester
TRC-D312515-10MG 10 mg

N,N’-Diacetyl-L-cystine Bis(tert-Butyl) Diester

Sign In for Pricing
View Details
GEM (NM_005261) Human Over-expression Lysate
LY401618 100 µg

GEM (NM_005261) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ALS2CR3 (TRAK2) activation kit by CRISPRa
GA112284 1 Kit

Human ALS2CR3 (TRAK2) activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
LRRC17 (NM_001031692) Human Over-expression Lysate
LY421903 100 µg

LRRC17 (NM_001031692) Human Over-expression Lysate

Sign In for Pricing
View Details