Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serpin A9 (SERPINA9)

Product Specifications

Product Name Alternative

Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11)

Abbreviation

Recombinant Human SERPINA9 protein

Gene Name

SERPINA9

UniProt

Q86WD7

Expression Region

24-417aa

Organism

Homo sapiens (Human)

Target Sequence

ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro) . Inhibits plasmin and thrombin with lower efficiency (in vitro) .

Molecular Weight

49.1 kDa

References & Citations

"Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells." Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M., Greiner T.C., McKeithan T.W., Chan W.C. Am. J. Pathol. 163:135-144 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf126 (1-168, His-tag) Human Protein
AR51327PU-S 100 µg

C14orf126 (1-168, His-tag) Human Protein

Sign In for Pricing
View Details
Camel Homeobox A1 (HOXA1) ELISA Kit
MBS9373974-01 48 Well

Camel Homeobox A1 (HOXA1) ELISA Kit

Sign In for Pricing
View Details
Camel Homeobox A1 (HOXA1) ELISA Kit
MBS9373974-02 96 Well

Camel Homeobox A1 (HOXA1) ELISA Kit

Sign In for Pricing
View Details
Camel Homeobox A1 (HOXA1) ELISA Kit
MBS9373974-03 5x 96 Well

Camel Homeobox A1 (HOXA1) ELISA Kit

Sign In for Pricing
View Details
Camel Homeobox A1 (HOXA1) ELISA Kit
MBS9373974-04 10x 96 Well

Camel Homeobox A1 (HOXA1) ELISA Kit

Sign In for Pricing
View Details
Human PTPRK knockout cell line
ABC-KH12436 1 Vial

Human PTPRK knockout cell line

Sign In for Pricing
View Details