What is the catalog number for Recombinant Human Serpin A9 (SERPINA9)?

The catalog number for Recombinant Human Serpin A9 (SERPINA9) is CSB-MP768223HU.

What sizes are available for Recombinant Human Serpin A9 (SERPINA9)?

Recombinant Human Serpin A9 (SERPINA9) is available in the following size(s): 10 µg, 50 µg, 200 µg, 500 µg, 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Serpin A9 (SERPINA9) come in?

Recombinant Human Serpin A9 (SERPINA9) is available in 7 different pack sizes.

Is Recombinant Human Serpin A9 (SERPINA9) in stock?

Recombinant Human Serpin A9 (SERPINA9) is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures Recombinant Human Serpin A9 (SERPINA9)?

Recombinant Human Serpin A9 (SERPINA9) is manufactured by Cusabio.

What is the estimated delivery time for Recombinant Human Serpin A9 (SERPINA9)?

Estimated delivery time for Recombinant Human Serpin A9 (SERPINA9) is approximately 15 business day(s), depending on your location.

Recombinant Human Serpin A9 (SERPINA9)

Product Specifications

Product Name Alternative

Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11)

Abbreviation

Recombinant Human SERPINA9 protein

Gene Name

SERPINA9

UniProt

Q86WD7

Expression Region

24-417aa

Organism

Homo sapiens (Human)

Target Sequence

ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro) . Inhibits plasmin and thrombin with lower efficiency (in vitro) .

Molecular Weight

49.1 kDa

References & Citations

"Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells." Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M., Greiner T.C., McKeithan T.W., Chan W.C. Am. J. Pathol. 163:135-144 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.