Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Apolipoprotein C-I (Apoc1)

Product Specifications

Product Name Alternative

Apolipoprotein C1 (Liver regeneration-related protein LRRG04)

Abbreviation

Recombinant Rat Apoc1 protein

Gene Name

Apoc1

UniProt

P19939

Expression Region

27-88aa

Organism

Rattus norvegicus (Rat)

Target Sequence

APDFSSAMESLPDKLKEFGNTLEDKARAAIEHIKQKEIMIKTRNWFSETLNKMKEKLKTTFA

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP) . Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP) . Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Molecular Weight

34.7 kDa

References & Citations

"Human apoA-I expression in CETP transgenic rats leads to lower levels of apoC-I in HDL and to magnification of CETP-mediated lipoprotein changes." Masson D., Pais de Barros J.P., Zak Z., Gautier T., Le Guern N., Assem M., Chisholm J.W., Paterniti J.R. Jr., Lagrost L. J. Lipid Res. 47:356-365 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GW4869
TRC-G019355-100MG 100 mg

GW4869

Sign In for Pricing
View Details
RNASE13 (NM_001012264) Human Over-expression Lysate
LY423312 100 µg

RNASE13 (NM_001012264) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, multi (KRT/457), CF640R conjugate, 0.1mg/mL
BNC400457-500 1x 500 µL

Cytokeratin, multi (KRT/457), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAP29 (BCAP29) (NM_018844) Human Recombinant Protein
TP303331 20 µg

BAP29 (BCAP29) (NM_018844) Human Recombinant Protein

Sign In for Pricing
View Details
Cholesteryl Linolenate
TRC-C432588-250MG 250 mg

Cholesteryl Linolenate

Sign In for Pricing
View Details
BubR1 (BUB1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10E7]
TA500606BM 100 µL

BubR1 (BUB1B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10E7]

Sign In for Pricing
View Details