Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human V-set and immunoglobulin domain-containing protein 1 (VSIG1), partial

Product Specifications

Product Name Alternative

Cell surface A33 antigen (Glycoprotein A34) (GPA34)

Abbreviation

Recombinant Human VSIG1 protein, partial

Gene Name

VSIG1

UniProt

Q86XK7

Expression Region

22-232aa

Organism

Homo sapiens (Human)

Target Sequence

VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.4 kDa

References & Citations

"Decreased expression of V-set and immunoglobulin domain containing 1 (VSIG1) is associated with poor prognosis in primary gastric cancer." Chen Y., Pan K., Li S., Xia J., Wang W., Chen J., Zhao J., Lu L., Wang D., Pan Q., Wang Q., Li Y., He J., Li Q. J Surg Oncol 106:286-293 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Violuric Acid
TRC-V634600-5G 5 g

Violuric Acid

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), 0.2mg/mL
BNUB1627-500 1x 500 µL

CD79a (B-Cell Marker) (ZL7-4), 0.2mg/mL

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-01 50 μL

MAP3K5 Antibody

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-02 100 µL

MAP3K5 Antibody

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-03 1 mL

MAP3K5 Antibody

Sign In for Pricing
View Details
Mouse Azgp1 activation kit by CRISPRa
GA200358 1 Kit

Mouse Azgp1 activation kit by CRISPRa

Sign In for Pricing
View Details