Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Oncostatin-M (Osm)

Product Specifications

Product Name Alternative

Osm; Oncostatin-M; OSM

Abbreviation

Recombinant Rat Osm protein

Gene Name

Osm

UniProt

Q65Z15

Expression Region

26-208aa

Organism

Rattus norvegicus (Rat)

Target Sequence

KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells (By similarity) . Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST) . Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Molecular Weight

24.2 kDa

References & Citations

"Oncostatin M inhibits proliferation of rat oval cells, OC15-5, inducing differentiation into hepatocytes." Okaya A., Kitanaka J., Kitanaka N., Satake M., Kim Y., Terada K., Sugiyama T., Takemura M., Fujimoto J., Terada N., Miyajima A., Tsujimura T. Am. J. Pathol. 166:709-719 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin B1 Monoclonal Antibody
MBS2548996-01 0.02 mL

Cyclin B1 Monoclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Monoclonal Antibody
MBS2548996-02 0.06 mL

Cyclin B1 Monoclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Monoclonal Antibody
MBS2548996-03 0.12 mL

Cyclin B1 Monoclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Monoclonal Antibody
MBS2548996-04 0.2 mL

Cyclin B1 Monoclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 Monoclonal Antibody
MBS2548996-05 5x 0.2 mL

Cyclin B1 Monoclonal Antibody

Sign In for Pricing
View Details
Gum ghatti
orb2938873-01 50 mg

Gum ghatti

Sign In for Pricing
View Details