Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter marburgensis F420-dependent NADP reductase (fno)

Product Specifications

Product Name Alternative

F420H2:NADP oxidoreductase

Abbreviation

Recombinant Methanothermobacter marburgensis F420-dependent NADP reductase protein

Gene Name

Fno

UniProt

D9PVP5

Expression Region

1-224aa

Organism

Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Target Sequence

MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Catalyzes the reduction of NADP (+) with F420H (2) via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions.

Molecular Weight

27.4 kDa

References & Citations

"F420H2:NADP oxidoreductase from Methanobacterium thermoautotrophicum: identification of the encoding gene via functional overexpression in Escherichia coli." Berk H., Thauer R.K. FEBS Lett. 438:124-126 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luteinizing Hormone Releasing Hormone Antibody
GWB-759674 0.05 mL

Luteinizing Hormone Releasing Hormone Antibody

Sign In for Pricing
View Details
KIAA0100 Peptide
DF15024-BP 1 mg

KIAA0100 Peptide

Sign In for Pricing
View Details
Lentiviral human MAGED2 shRNA (UAS) - Lentiviral human MAGED2 shRNA (UAS, RFP) (25)
GTR15351782 1 Vial

Lentiviral human MAGED2 shRNA (UAS) - Lentiviral human MAGED2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CHAF1A Antibody
MBS7110115-01 0.05 mg

CHAF1A Antibody

Sign In for Pricing
View Details
CHAF1A Antibody
MBS7110115-02 0.1 mg

CHAF1A Antibody

Sign In for Pricing
View Details
CHAF1A Antibody
MBS7110115-03 5x 0.1 mg

CHAF1A Antibody

Sign In for Pricing
View Details