Recombinant Human Blood group Rh (D) polypeptide (RHD), partial
Product Specifications
Product Name Alternative
RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240D
Abbreviation
Recombinant Human RHD protein, partial
Gene Name
RHD
UniProt
Q02161
Expression Region
388-417aa
Organism
Homo sapiens (Human)
Target Sequence
LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Tag
N-terminal GST-tagged
Type
Developed Protein
Source
Mammalian cell
Field of Research
Cardiovascular
Relevance
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Molecular Weight
29.6 kDa
References & Citations
"Rh (D) antigen expression and isolation of a new Rh (D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981 (1994)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
S1014-67M3-ML405 100 µL
SLUG, NT (K9) (Zinc Finger Protein SNAI2, Neural Crest Transcription Factor Slug, Protein Snail Homolog 2, SNAI2, SLUGH) (MaxLight 405) discontinued
Sign In for Pricing
View Details 
GTR15286940 1 Vial
Lentiviral human ITGAE shRNA (UAS) - Lentiviral human ITGAE shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
DZ41629-Fluoro594 200 µL/Vial
Anti-Human SKA1 Antibody Fluoro594 Conjugated
Sign In for Pricing
View Details 146682 100 µg
IDH1 (Isocitrate Dehydrogenase [NADP] Cytoplasmic, IDH, Cytosolic NADP-isocitrate Dehydrogenase, IDP, NADP (+) -specific ICDH, Oxalosuccinate Decarboxylase, PICD)
Sign In for Pricing
View Details MBS624756-01 0.2 mL
TSPAN31, ID (Tetraspanin-31, Tspan-31, Sarcoma-amplified Sequence, SAS, TSPAN31)
Sign In for Pricing
View Details