Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cathepsin O (CTSO)

Product Specifications

Product Name Alternative

CTSO1

Abbreviation

Recombinant Human CTSO protein

Gene Name

CTSO

UniProt

P43234

Expression Region

108-321aa

Organism

Homo sapiens (Human)

Target Sequence

LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Relevance

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.

Molecular Weight

28.5 kDa

References & Citations

"First genome-wide association scan on neurophysiological endophenotypes points to trans-regulation effects on SLC2A3 in dyslexic children." Roeske D., Ludwig K.U., Neuhoff N., Becker J., Bartling J., Bruder J., Brockschmidt F.F., Warnke A., Remschmidt H., Hoffmann P., Muller-Myhsok B., Nothen M.M., Schulte-Korne G. Mol. Psychiatry 16:97-107 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rasgrf1 Rabbit Polyclonal Antibody
AP20328PU-N 100 µg

Rasgrf1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MRPL46 (NM_022163) Human Over-expression Lysate
LC402916 20 µg

MRPL46 (NM_022163) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Smooth muscle
CR563020 5 µg

Tissue Total RNA, Smooth muscle

Sign In for Pricing
View Details
Calcipressin 1 (RCAN1) (NM_004414) Human Recombinant Protein
TP320434L 1 mg

Calcipressin 1 (RCAN1) (NM_004414) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS709226 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), Biotin conjugate, 0.1mg/mL
BNCB3286-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3286), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details