Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

Product Specifications

Product Name Alternative

Tlr7; Toll-like receptor 7

Abbreviation

Recombinant Mouse Tlr7 protein, partial

Gene Name

Tlr7

UniProt

P58681

Expression Region

27-348aa

Organism

Mus musculus (Mouse)

Target Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Molecular Weight

40.8 kDa

References & Citations

"The interaction between the ER membrane protein UNC93B and TLR3, 7, and 9 is crucial for TLR signaling." Brinkmann M.M., Spooner E., Hoebe K., Beutler B., Ploegh H.L., Kim Y.M. J. Cell Biol. 177:265-275 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH2 Antibody
8C15547-AAT 50 µg

MARCH2 Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-01 20 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-02 60 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-03 120 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
LBR Polyclonal Antibody
E-AB-15166-04 200 µL

LBR Polyclonal Antibody

Sign In for Pricing
View Details
SPATA31C1 Human Gene Knockout Kit (CRISPR)
KN426677 1 Kit

SPATA31C1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details