Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testisin (PRSS21)

Product Specifications

Product Name Alternative

Eosinophil serine protease 1

Abbreviation

Recombinant Human PRSS21 protein

Gene Name

PRSS21

UniProt

Q9Y6M0

Expression Region

42-288aa

Organism

Homo sapiens (Human)

Target Sequence

IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Could regulate proteolytic events associated with testicular germ cell maturation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Could regulate proteolytic events associated with testicular germ cell maturation.

Molecular Weight

31.8 kDa

References & Citations

"Testisin, a new human serine proteinase expressed by premeiotic testicular germ cells and lost in testicular germ cell tumors." Hooper J.D., Nicol D.L., Dickinson J.L., Eyre H.J., Scarman A.L., Normyle J.F., Stuttgen M.A., Douglas M.L., Loveland K.A., Sutherland G.R., Antalis T.M. Cancer Res. 59:3199-3205 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cell Cycle Progression Protein 1 (CCPG1) ELISA Kit
abx386365 96 Tests

Human Cell Cycle Progression Protein 1 (CCPG1) ELISA Kit

Sign In for Pricing
View Details
Human Baculoviral IAP repeat-containing protein 7 (BIRC7) ELISA Kit
orb1947926-01 48 Tests

Human Baculoviral IAP repeat-containing protein 7 (BIRC7) ELISA Kit

Sign In for Pricing
View Details
Human Baculoviral IAP repeat-containing protein 7 (BIRC7) ELISA Kit
orb1947926-02 96 Tests

Human Baculoviral IAP repeat-containing protein 7 (BIRC7) ELISA Kit

Sign In for Pricing
View Details
Human phosphoenolpyruvate carboxykinase (PCK) Elisa Kit
EK711296 96 Well

Human phosphoenolpyruvate carboxykinase (PCK) Elisa Kit

Sign In for Pricing
View Details
Anti-Adiponectin Receptor 1 (ADIPOR1)
FY-AB48458-01 1 mL

Anti-Adiponectin Receptor 1 (ADIPOR1)

Sign In for Pricing
View Details
Anti-Adiponectin Receptor 1 (ADIPOR1)
FY-AB48458-02 100 µL

Anti-Adiponectin Receptor 1 (ADIPOR1)

Sign In for Pricing
View Details