Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)

Product Specifications

Product Name Alternative

Adenosine 5'-monophosphoramidase P13.7

Abbreviation

Recombinant Rabbit HINT1 protein

Gene Name

HINT1

UniProt

P80912

Expression Region

2-126aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity) . Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) . Hydrolyzes lysyl-AMP (AMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Functions as enzyme, and as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity) . Hydrolyzes purine nucleotide phosphoramidates, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate) . Hydrolyzes lysyl-AMP (AMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) generated by lysine tRNA ligase, lysyl-GMP (GMP-N-epsilon- (N-alpha-acetyl lysine methyl ester) ) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide.

Molecular Weight

17.6 kDa

References & Citations

"Adenosine monophosphoramidase activity of Hint and Hnt1 supports function of Kin28, Ccl1, and Tfb3."Bieganowski P., Garrison P.N., Hodawadekar S.C., Faye G., Barnes L.D., Brenner C.J. Biol. Chem. 277:10852-10860 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPRT Antibody (YA3000, Rabbit)
HY-P83255-01 10 µL

HPRT Antibody (YA3000, Rabbit)

Sign In for Pricing
View Details
HPRT Antibody (YA3000, Rabbit)
HY-P83255-02 50 μL

HPRT Antibody (YA3000, Rabbit)

Sign In for Pricing
View Details
HPRT Antibody (YA3000, Rabbit)
HY-P83255-03 100 µL

HPRT Antibody (YA3000, Rabbit)

Sign In for Pricing
View Details
Multi Purpose Vert Oven - 535L
OVE2032 1 Each

Multi Purpose Vert Oven - 535L

Sign In for Pricing
View Details
SRM (Spermidine Synthase, PAPT, SPDSY, SPS1, SRML1)
252092 200 µL

SRM (Spermidine Synthase, PAPT, SPDSY, SPS1, SRML1)

Sign In for Pricing
View Details
RPS10P24 3'UTR GFP Stable Cell Line
TU071909 1.0 mL

RPS10P24 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details