Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Complement factor D (Cfd)

Product Specifications

Product Name Alternative

Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

Abbreviation

Recombinant Rat Cfd protein

Gene Name

Cfd

UniProt

P32038

Expression Region

26-263aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.

Molecular Weight

29.8 kDa

References & Citations

"Purification and partial characterization of rat factor D."Baker B.C., Campbell C.J., Grinham C.J., Turcatti G.Biochem. J. 279:775-779 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS2505587-01 24 Tests (Limit 1)

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit

Sign In for Pricing
View Details
Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS2505587-02 48 Tests

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit

Sign In for Pricing
View Details
Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS2505587-03 96 Tests

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit

Sign In for Pricing
View Details
Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS2505587-04 5x 96 Tests

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit

Sign In for Pricing
View Details
Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit
MBS2505587-05 10x 96 Tests

Mouse DNASE1 (Deoxyribonuclease I) ELISA Kit

Sign In for Pricing
View Details
Recombinant Blochmannia floridanus Cell division topological specificity factor (minE)
MBS1439488-01 0.02 mg (E-Coli)

Recombinant Blochmannia floridanus Cell division topological specificity factor (minE)

Sign In for Pricing
View Details