Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saxiphilin, partial for Lithobates catesbeiana, partial

Product Specifications

Product Name Alternative

SAX

Abbreviation

Recombinant Saxiphilin protein, partial for Lithobates catesbeiana protein, partial

UniProt

P31226

Expression Region

484-844aa

Organism

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Target Sequence

AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Tag

N-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Microbiology

Relevance

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe3+. It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe (3+) . It may participate in a detoxification mechanism for neutralizing a microbial toxin.

Molecular Weight

43.7 kDa

References & Citations

"Purification and partial sequencing of saxiphilin, a saxitoxin-binding protein from the bullfrog, reveals homology to transferrin."Li Y., Moczydlowski E.J. Biol. Chem. 266:15481-15487 (1991) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF640R conjugate, 0.1mg/mL
BNC401983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GM-CSF Recombinant Rabbit Monoclonal Antibody [PS01-38] - BSA and Azide free (Detector)
HA721289 100 µL

Human GM-CSF Recombinant Rabbit Monoclonal Antibody [PS01-38] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
LINC01341 Human qPCR Primer Pair (NM_207326)
HP219649 200 Reactions

LINC01341 Human qPCR Primer Pair (NM_207326)

Sign In for Pricing
View Details
8-Undecyl-7H,8H,9H-dinaphtho[1,8-bc:1',8'-hi]xanthene-7,9-dione
TRC-U788995-5MG 5 mg

8-Undecyl-7H,8H,9H-dinaphtho[1,8-bc:1',8'-hi]xanthene-7,9-dione

Sign In for Pricing
View Details
Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL
BNC741118-500 1x 500 µL

Beta-2-Microglobulin (B2M) (B2M/1118), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium (3R,5R)-7-(2-(4-Chlorophenyl)-5-isopropyl-3-phenyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)-3,5-dihydroxyheptanoate
TRC-S960223-1MG 1 mg

Sodium (3R,5R)-7-(2-(4-Chlorophenyl)-5-isopropyl-3-phenyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)-3,5-dihydroxyheptanoate

Sign In for Pricing
View Details