Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus 14 kDa fusion protein (A27L)

Product Specifications

Product Name Alternative

A27L; A30L14 kDa fusion protein

Abbreviation

Recombinant Smallpox virus A27L protein

Gene Name

A27L

UniProt

P33816

Expression Region

1-110aa

Organism

Smallpox virus

Target Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Microbiology

Relevance

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV) . The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity) .

Molecular Weight

15.0 kDa

References & Citations

"Real-time PCR system for detection of orthopoxviruses and simultaneous identification of smallpox virus."Olson V.A., Laue T., Laker M.T., Babkin I.V., Drosten C., Shchelkunov S.N., Niedrig M., Damon I.K., Meyer H.J. Clin. Microbiol. 42:1940-1946 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH5 Polyclonal Antibody
E-AB-53193-01 20 µL

CDH5 Polyclonal Antibody

Sign In for Pricing
View Details
CDH5 Polyclonal Antibody
E-AB-53193-02 60 μL

CDH5 Polyclonal Antibody

Sign In for Pricing
View Details
CDH5 Polyclonal Antibody
E-AB-53193-03 120 μL

CDH5 Polyclonal Antibody

Sign In for Pricing
View Details
CDH5 Polyclonal Antibody
E-AB-53193-04 200 µL

CDH5 Polyclonal Antibody

Sign In for Pricing
View Details
ASAH1 (Acid Ceramidase, AC, ACDase, Acid CDase, Acylsphingosine Deacylase, N-acylsphingosine Amidohydrolase, Putative 32kD Heart Protein, PHP32, ASAH, HSD33, HSD-33) (FITC)
123590-FITC 100 µL

ASAH1 (Acid Ceramidase, AC, ACDase, Acid CDase, Acylsphingosine Deacylase, N-acylsphingosine Amidohydrolase, Putative 32kD Heart Protein, PHP32, ASAH, HSD33, HSD-33) (FITC)

Sign In for Pricing
View Details
Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit
RDR-NURR1-Hu-96Tests 96 Tests

Human Nuclear Receptor Related Protein 1 (NURR1) ELISA Kit

Sign In for Pricing
View Details