Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Erythropoietin (EPO)

Product Specifications

Abbreviation

Recombinant Rhesus macaque EPO protein

Gene Name

EPO

UniProt

Q28513

Expression Region

28-192aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

APPRLVCDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRIEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myb-related protein B (MYBL2) Elisa Kit
EK713089 96 Well

Human Myb-related protein B (MYBL2) Elisa Kit

Sign In for Pricing
View Details
Molnupiravir (Standard)
HY-135853R-01 5 mg

Molnupiravir (Standard)

Sign In for Pricing
View Details
Molnupiravir (Standard)
HY-135853R-02 10 mg

Molnupiravir (Standard)

Sign In for Pricing
View Details
Molnupiravir (Standard)
HY-135853R-03 25 mg

Molnupiravir (Standard)

Sign In for Pricing
View Details
Molnupiravir (Standard)
HY-135853R-04 50 mg

Molnupiravir (Standard)

Sign In for Pricing
View Details
Molnupiravir (Standard)
HY-135853R-05 100 mg

Molnupiravir (Standard)

Sign In for Pricing
View Details