Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial

Product Specifications

Product Name Alternative

Triggering receptor expressed on monocytes 2

Abbreviation

Recombinant Mouse Trem2 protein, partial

Gene Name

Trem2

UniProt

Q99NH8

Expression Region

19-171aa

Organism

Mus musculus (Mouse)

Target Sequence

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS

Tag

N-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Molecular Weight

20.8 kDa

References & Citations

"Cloning and characterization of a novel mouse myeloid DAP12-associated receptor family."Daws M.R., Lanier L.L., Seaman W.E., Ryan J.C.Eur. J. Immunol. 31:783-791 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPCR150 (GPR160) (C-term) Rabbit Polyclonal Antibody
AP51922PU-N 400 µL

GPCR150 (GPR160) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
o-Iodochlorobenzene
TRC-I694400-50G 50 g

o-Iodochlorobenzene

Sign In for Pricing
View Details
CDC42 Recombinant Rabbit monoclonal Antibody
HA750320 100 µL

CDC42 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CDH15 Antibody
8C12090-AAT 50 µg

CDH15 Antibody

Sign In for Pricing
View Details
Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI11C5]
CF805653 100 µg

Rb (RB1) Mouse Monoclonal Antibody [Clone ID: OTI11C5]

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), 1mg/mL
BNUM0833-50 1x 50 µL

Calponin-1 (CALP + CNN1/832), 1mg/mL

Sign In for Pricing
View Details