Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial

Product Specifications

Product Name Alternative

GP1,2 Short name: GP

Abbreviation

Recombinant Sudan ebolavirus GP protein, partial

Gene Name

GP

UniProt

Q7T9D9

Expression Region

502-637aa

Organism

Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)

Target Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Tag

N-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

GP1 is responsible for binding to the receptor (s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection) . Binding to the macrophage specific lectin CLEC10A also seems to enhance virus infectivity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

GP1 is responsible for binding to the receptor (s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection) . Binding to the macrophage specific lectin CLEC10A also seem to enhance virus infectivity. Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection. Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L presumably induces a conformational change of GP2, allowing its binding to the host entry receptor NPC1 and unmasking its fusion peptide to initiate membranes fusion.

Molecular Weight

19.4 kDa

References & Citations

"The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing."Sanchez A., Trappier S.G., Mahy B.W.J., Peters C.J., Nichol S.T.Proc. Natl. Acad. Sci. U.S.A. 93:3602-3607 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCC antibody
orb73981 100 µL

FANCC antibody

Sign In for Pricing
View Details
IL17 (IL17A) Mouse Monoclonal Antibody [Clone:13E7]
E45M21680 100 µg

IL17 (IL17A) Mouse Monoclonal Antibody [Clone:13E7]

Sign In for Pricing
View Details
Human AQP10 qPCR Primer Pair
QH57485S 200 Tests

Human AQP10 qPCR Primer Pair

Sign In for Pricing
View Details
CGP71683 hydrochloride
orb1301667-01 1 mg

CGP71683 hydrochloride

Sign In for Pricing
View Details
CGP71683 hydrochloride
orb1301667-02 5 mg

CGP71683 hydrochloride

Sign In for Pricing
View Details
CGP71683 hydrochloride
orb1301667-03 1 ml x 10 mM (in DMSO)

CGP71683 hydrochloride

Sign In for Pricing
View Details