Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) -VLPs

Product Specifications

Product Name Alternative

(KK-LC-1) (Cancer/testis antigen 83)

Abbreviation

Recombinant Human CT83 protein-VLPs

Gene Name

CT83

UniProt

Q5H943

Expression Region

1-113aa

Organism

Homo sapiens (Human)

Target Sequence

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Tag

N-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)

Type

MP-VLP Transmembrane Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

14 kDa

References & Citations

"Cancer-testis antigen KK-LC-1 is a potential biomarker associated with immune cell infiltration in lung adenocarcinoma." Kang Y., Gan Y., Jiang Y., You J., Huang C., Chen Q., Xu X., Chen F., Chen L. BMC Cancer 22:834-834 (2022)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV3-31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV765114 1.0 µg DNA

IGKV3-31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
LEDGF, Recombinant, Human (Lens Epithelium-derived Growth Factor, Transcriptional Coactivator p75/p52, PSIP1, PC4 and SFRS1-interacting Protein, PSIP2, DFS70, Dense Fine Speckles 70kD Protein, PAIP, CLL-associated Antigen KW-7)
L1662-89M 50 µg

LEDGF, Recombinant, Human (Lens Epithelium-derived Growth Factor, Transcriptional Coactivator p75/p52, PSIP1, PC4 and SFRS1-interacting Protein, PSIP2, DFS70, Dense Fine Speckles 70kD Protein, PAIP, CLL-associated Antigen KW-7)

Sign In for Pricing
View Details
TTC9B, CT (TTC9B, Tetratricopeptide repeat protein 9B) (MaxLight 750)
MBS6359989-01 0.1 mL

TTC9B, CT (TTC9B, Tetratricopeptide repeat protein 9B) (MaxLight 750)

Sign In for Pricing
View Details
TTC9B, CT (TTC9B, Tetratricopeptide repeat protein 9B) (MaxLight 750)
MBS6359989-02 5x 0.1 mL

TTC9B, CT (TTC9B, Tetratricopeptide repeat protein 9B) (MaxLight 750)

Sign In for Pricing
View Details
RPL15 (N-term) Rabbit Polyclonal Antibody
AP53708PU-N 400 µL

RPL15 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMPR1A (Acvrlk3, Bmpr, CD292, ALK-3, BMPR-1A, BMP type-1A receptor, SKR5, Activin receptor-like kinase 3, BMP-2/BMP-4 receptor, Serine/threonine-protein kinase receptor R5, ACTIVIN A RECEPTOR, TYPE II-LIKE KINASE 3) (MaxLight 405) discontinued
144242-ML405 100 µL

BMPR1A (Acvrlk3, Bmpr, CD292, ALK-3, BMPR-1A, BMP type-1A receptor, SKR5, Activin receptor-like kinase 3, BMP-2/BMP-4 receptor, Serine/threonine-protein kinase receptor R5, ACTIVIN A RECEPTOR, TYPE II-LIKE KINASE 3) (MaxLight 405) discontinued

Sign In for Pricing
View Details