Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial

Product Specifications

Product Name Alternative

CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name: ILT-11 Leukocyte immunoglobulin-like receptor 9 Short name: LIR-9 CD_antigen: CD85f

Abbreviation

Recombinant Human LILRA5 protein, partial

Gene Name

LILRA5

UniProt

A6NI73

Expression Region

42-268aa

Organism

Homo sapiens (Human)

Target Sequence

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Tag

N-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Molecular Weight

29.2 kDa

References & Citations

"Crystal structure of the human monocyte-activating receptor, 'Group 2' leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11) ."Shiroishi M., Kajikawa M., Kuroki K., Ose T., Kohda D., Maenaka K.J. Biol. Chem. 281:19536-19544 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

frizzled-3 Lentiviral Activation Particles (h2)
sc-403362-LAC-2 200 µL

frizzled-3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RPRD2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1998704 1.0 µg DNA

RPRD2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human FLT1/VEGFR1 Protein, C-Fc
HB265021-01 50 µg

Recombinant Human FLT1/VEGFR1 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human FLT1/VEGFR1 Protein, C-Fc
HB265021-02 100 µg

Recombinant Human FLT1/VEGFR1 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human FLT1/VEGFR1 Protein, C-Fc
HB265021-03 1 mg

Recombinant Human FLT1/VEGFR1 Protein, C-Fc

Sign In for Pricing
View Details
4930505A04Rik (BC049719) Mouse Tagged ORF Clone
MR201208 10 µg

4930505A04Rik (BC049719) Mouse Tagged ORF Clone

Sign In for Pricing
View Details