Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

Abbreviation

Recombinant Human SNCA protein

Gene Name

SNCA

UniProt

P37840

Expression Region

1-140aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca2+ release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs Soluble NSF Attachment Protein REceptors at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter DAT1 and thereby modulating its activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chlorobenzophenone
TRC-C373675-20G 20 g

3-Chlorobenzophenone

Sign In for Pricing
View Details
CCDC159 (NM_001080503) Human Recombinant Protein
TP319680M 100 µg

CCDC159 (NM_001080503) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-GALNT9
Y058492 100 µL

Anti-GALNT9

Sign In for Pricing
View Details
Atp13a3 Mouse Gene Knockout Kit (CRISPR)
KN501765 1 Kit

Atp13a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MUSTN1 (NM_205853) Human Over-expression Lysate
LC404202 20 µg

MUSTN1 (NM_205853) Human Over-expression Lysate

Sign In for Pricing
View Details
ACBD3 Human Knockdown Lysate
LY300021 100 µg

ACBD3 Human Knockdown Lysate

Sign In for Pricing
View Details