Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-synuclein (SNCA)

Product Specifications

Product Name Alternative

Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP

Abbreviation

Recombinant Human SNCA protein

Gene Name

SNCA

UniProt

P37840

Expression Region

1-140aa

Organism

Homo sapiens (Human)

Target Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release. Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca2+ release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs Soluble NSF Attachment Protein REceptors at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter DAT1 and thereby modulating its activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Histone H3 (S28) Recombinant Rabbit Monoclonal Antibody [JE56-06]
HA721795 100 µL

Phospho-Histone H3 (S28) Recombinant Rabbit Monoclonal Antibody [JE56-06]

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2956), CF647 conjugate, 0.1mg/mL
BNC472956-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2956), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF568 conjugate, 0.1mg/mL
BNC683065-100 1x 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), Biotin conjugate, 0.1mg/mL
BNCB1629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF488A conjugate, 0.1mg/mL
BNC882121-100 1x 100 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2121), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFNAR2 Human Gene Knockout Kit (CRISPR)
KN401212 1 Kit

IFNAR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details