Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Mouse (HEK293, Fc)

The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-mouse-hek293-fc.html

Purity

95.0

Smiles

CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

Molecular Formula

60504 (Gene_ID) Q9JHX3 (C20-P236) (Accession)

Molecular Weight

63-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Kit Rabbit pAb
MBS8542430-01 0.1 mL

c-Kit Rabbit pAb

Sign In for Pricing
View Details
c-Kit Rabbit pAb
MBS8542430-02 0.1 mL (AF405L)

c-Kit Rabbit pAb

Sign In for Pricing
View Details
c-Kit Rabbit pAb
MBS8542430-03 0.1 mL (AF405S)

c-Kit Rabbit pAb

Sign In for Pricing
View Details
c-Kit Rabbit pAb
MBS8542430-04 0.1 mL (AF610)

c-Kit Rabbit pAb

Sign In for Pricing
View Details
c-Kit Rabbit pAb
MBS8542430-05 0.1 mL (AF635)

c-Kit Rabbit pAb

Sign In for Pricing
View Details
c-Kit Rabbit pAb
MBS8542430-06 0.1 mL (APC)

c-Kit Rabbit pAb

Sign In for Pricing
View Details