Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF kappaB p65, phosphorylated (Thr254)
525942-01 100 µL

NF kappaB p65, phosphorylated (Thr254)

Sign In for Pricing
View Details
NF kappaB p65, phosphorylated (Thr254)
525942-02 200 µL

NF kappaB p65, phosphorylated (Thr254)

Sign In for Pricing
View Details
PLK1 3'UTR Luciferase Stable Cell Line
TU018276 1.0 mL

PLK1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396588 2 mL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 nsp13-IN-5
MBS5806283 Inquire

SARS-CoV-2 nsp13-IN-5

Sign In for Pricing
View Details
Rabbit a-Goat IgG, Horseradish Peroxidase (HRP) Labeled
B2018390 1 mL

Rabbit a-Goat IgG, Horseradish Peroxidase (HRP) Labeled

Sign In for Pricing
View Details