Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 Recombinant Rabbit mAb
BS49625-01 50 µL

BRCA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
BRCA1 Recombinant Rabbit mAb
BS49625-02 100 µL

BRCA1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
HBS1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B6]
TA800567BM 100 µL

HBS1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B6]

Sign In for Pricing
View Details
Tjap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4704805 3x 1.0 µg

Tjap1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human 5-HT1E (NP_000856) VersaClone cDNA
RDC0286 10 µg

Human 5-HT1E (NP_000856) VersaClone cDNA

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD31 Antibody
JOT21990F 25μg

PE/Cyanine5.5 Anti-Mouse CD31 Antibody

Sign In for Pricing
View Details