Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Apolipoprotein A1 ELISA Kit
MBS018863-01 48 Well

Hamster Apolipoprotein A1 ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein A1 ELISA Kit
MBS018863-02 96 Well

Hamster Apolipoprotein A1 ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein A1 ELISA Kit
MBS018863-03 5x 96 Well

Hamster Apolipoprotein A1 ELISA Kit

Sign In for Pricing
View Details
Hamster Apolipoprotein A1 ELISA Kit
MBS018863-04 10x 96 Well

Hamster Apolipoprotein A1 ELISA Kit

Sign In for Pricing
View Details
Mouse MSMP siRNA
abx924801-01 15 nmol

Mouse MSMP siRNA

Sign In for Pricing
View Details
Mouse MSMP siRNA
abx924801-02 30 nmol

Mouse MSMP siRNA

Sign In for Pricing
View Details