Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Phospho-RPS6KB1-(T421) antibody
STJ22390 100 µl

Anti-Phospho-RPS6KB1-(T421) antibody

Sign In for Pricing
View Details
Glycidyl Laurate-d5 (1.0 mg/mL in isopropanol)
TRC-KIT8377-1X1ML 1 mL

Glycidyl Laurate-d5 (1.0 mg/mL in isopropanol)

Sign In for Pricing
View Details
Human MIR6847 qPCR Primer Pair
QH86493S 200 Tests

Human MIR6847 qPCR Primer Pair

Sign In for Pricing
View Details
CLPTM1L Lentiviral Activation Particles (m2)
sc-432295-LAC-2 200 µL

CLPTM1L Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
CRAT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0504505 3x 1.0 µg

CRAT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Steap1 Rat siRNA Oligo Duplex (Locus ID 297738)
SR510923 1 Kit

Steap1 Rat siRNA Oligo Duplex (Locus ID 297738)

Sign In for Pricing
View Details