Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MVP (NM_005115) Human Tagged ORF Clone Lentiviral Particle
RC204841L2V 200 µL

MVP (NM_005115) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Plant Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit
MBS9370787 Inquire

Plant Mitotic Checkpoint Serine/Threonine-Protein Kinase BUB1 Beta (BUB1B) ELISA Kit

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: UMAB249]
UM800141CF 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: UMAB249]

Sign In for Pricing
View Details
RPL13 Rabbit pAb
E45R25405N-100 100 µL

RPL13 Rabbit pAb

Sign In for Pricing
View Details
LOC136242 (PRSS37) (NM_001008270) Human Over-expression Lysate
LC423410 20 µg

LOC136242 (PRSS37) (NM_001008270) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human FANCF Protein - (Dry Ice)
H00002188-P01-2ug 2 µg

Recombinant Human FANCF Protein - (Dry Ice)

Sign In for Pricing
View Details