Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mcat qPCR Primer Pair
QM57014S 200 Tests

Mouse Mcat qPCR Primer Pair

Sign In for Pricing
View Details
MMD Protein Vector (Mouse) (pPB-N-His)
PV201215 500 ng

MMD Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human PTH1R/PTHR1 MAb (Clone 542407)
MAB57091-SP 25 µg

Human PTH1R/PTHR1 MAb (Clone 542407)

Sign In for Pricing
View Details
COCH antibody
70R-9822 50 ug

COCH antibody

Sign In for Pricing
View Details
Canine 6-phosphofructokinase, muscle type, PFKM ELISA KIT
ELI-02496d 96 Tests

Canine 6-phosphofructokinase, muscle type, PFKM ELISA KIT

Sign In for Pricing
View Details
Mouse Cldn34b1 qPCR Primer Pair
QM78426S 200 Tests

Mouse Cldn34b1 qPCR Primer Pair

Sign In for Pricing
View Details