Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Babesia & Theileria
MulOneq-V864-50D 50 Reactions

Multiplex Babesia & Theileria

Sign In for Pricing
View Details
Mouse Monoclonal Melanotropin beta Antibody (r57) [Alexa Fluor 750]
NBP2-54342AF750 0.1 mL

Mouse Monoclonal Melanotropin beta Antibody (r57) [Alexa Fluor 750]

Sign In for Pricing
View Details
Mouse Anti-Porcine Endogenous Retrovirus (PERV) Monoclonal Antibody
VD7N195 1 Each

Mouse Anti-Porcine Endogenous Retrovirus (PERV) Monoclonal Antibody

Sign In for Pricing
View Details
pLV2-CMV-CHAC2-FLAG-Puro Plasmid
PVT54091 2 µg

pLV2-CMV-CHAC2-FLAG-Puro Plasmid

Sign In for Pricing
View Details
NANOS2 Protein Vector (Rat) (pPB-N-His)
PV284319 500 ng

NANOS2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CBFB Human qPCR Primer Pair (NM_022845)
HP225611 200 Reactions

CBFB Human qPCR Primer Pair (NM_022845)

Sign In for Pricing
View Details