Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morphazinamide
TRC-M651765-500MG 500 mg

Morphazinamide

Sign In for Pricing
View Details
Aldolase (ALDOA) (NM_000034) Human Tagged ORF Clone Lentiviral Particle
RC202576L2V 200 µL

Aldolase (ALDOA) (NM_000034) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Abcb8 Rat shRNA Lentiviral Particle (Locus ID 362302)
TL700941V 500 µL Each

Abcb8 Rat shRNA Lentiviral Particle (Locus ID 362302)

Sign In for Pricing
View Details
Olfr1414 sgRNA CRISPR Lentivector set (Mouse)
K4182301 3x 1.0 µg

Olfr1414 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Nbl1 (NM_031609) Rat Untagged Clone
RN204641 10 µg

Nbl1 (NM_031609) Rat Untagged Clone

Sign In for Pricing
View Details
RAI1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38452124 3x 1.0µg DNA

RAI1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details