Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3)
313672-01 50 µg

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3)

Sign In for Pricing
View Details
XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3)
313672-02 100 µg

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3)

Sign In for Pricing
View Details
Anti-MARV Envelope glycoprotein (GP) Human IgA ELISA Kit
MBS1586346-01 96 Tests

Anti-MARV Envelope glycoprotein (GP) Human IgA ELISA Kit

Sign In for Pricing
View Details
Anti-MARV Envelope glycoprotein (GP) Human IgA ELISA Kit
MBS1586346-02 5x 96 Tests

Anti-MARV Envelope glycoprotein (GP) Human IgA ELISA Kit

Sign In for Pricing
View Details
Nefh sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6860607 1.0 µg DNA

Nefh sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
9,9-diphenyl- 9H-fluoren-2-ol
JH919876 1 Each

9,9-diphenyl- 9H-fluoren-2-ol

Sign In for Pricing
View Details