Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CC130, ID (CCDC130, Coiled-coil domain-containing protein 130, 9kD protein) (MaxLight 405) discontinued
033263-ML405 100 µL

CC130, ID (CCDC130, Coiled-coil domain-containing protein 130, 9kD protein) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit anti Human DICER1
X2756P 100 µg

Rabbit anti Human DICER1

Sign In for Pricing
View Details
Human CCDC140 (NM_153038) AAV Particle
RC222414A1V 250 µL

Human CCDC140 (NM_153038) AAV Particle

Sign In for Pricing
View Details
RN5S330 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV744765 1.0 µg DNA

RN5S330 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Srm sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3048605 3x 1.0 µg

Srm sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
RASAL1 Antibody
R35254-100UG 100 µg

RASAL1 Antibody

Sign In for Pricing
View Details