Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT12 (1Q8) Mouse Monoclonal antibody
E28PE4784 100 µL

NUDT12 (1Q8) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Pcdhb10 shRNA (UAS) - Lentiviral mouse Pcdhb10 shRNA (UAS, iRFP) plasmid
GTR15164956 1 Vial

Lentiviral mouse Pcdhb10 shRNA (UAS) - Lentiviral mouse Pcdhb10 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
EXT2 sgRNA CRISPR Lentivector set (Human)
K0704701 3x 1.0 µg

EXT2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12)
302354 200 µL

CHST12 (Carbohydrate Sulfotransferase 12, Chondroitin 4-O-Sulfotransferase 2, Chondroitin 4-Sulfotransferase 2, C4ST-2, C4ST2, Sulfotransferase Hlo, CHST12)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FBL23 Polyclonal Antibody
MBS9010522 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FBL23 Polyclonal Antibody

Sign In for Pricing
View Details
6-Azidohexan-1-amine (~90%)
TRC-A965850-10MG 10 mg

6-Azidohexan-1-amine (~90%)

Sign In for Pricing
View Details