Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orion Star A214 pH/ISE Benchtop Meter Kit for Ammonia
STARA2146 1 Each

Orion Star A214 pH/ISE Benchtop Meter Kit for Ammonia

Sign In for Pricing
View Details
CDK9-CCNK Heterodimer, Human (Active, sf9, GST, Flag, His)
HY-P702924 1 Each

CDK9-CCNK Heterodimer, Human (Active, sf9, GST, Flag, His)

Sign In for Pricing
View Details
Polyclonal TREM1 Antibody
APG03015G 0.1 mg

Polyclonal TREM1 Antibody

Sign In for Pricing
View Details
FBXO27 Protein Vector (Human) (pPB-C-His)
PV015857 500 ng

FBXO27 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Xpress™ Human STK11 Over-expressing Stable Cell Line
ABC-X3028 1 Vial

Xpress™ Human STK11 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Anti-TBC1D21 Antibody
CTA2697-01 30 µL

Anti-TBC1D21 Antibody

Sign In for Pricing
View Details