Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR562539 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Human Tyrosinase antibody,TYR Ab ELISA KIT
JOT-EK2146Hu 96 wells

Human Tyrosinase antibody,TYR Ab ELISA KIT

Sign In for Pricing
View Details
4-Hydroxychlorpropham-d7 Sulfate Sodium Salt
TRC-H825077-25MG 25 mg

4-Hydroxychlorpropham-d7 Sulfate Sodium Salt

Sign In for Pricing
View Details
Integrin alphaV, beta5 discontinued
I7661-37L 25 µg

Integrin alphaV, beta5 discontinued

Sign In for Pricing
View Details
Hhat (BC008159) Mouse Tagged ORF Clone
MG207568 10 µg

Hhat (BC008159) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Ddx21 shRNA (UAS) - Lentiviral mouse Ddx21 shRNA (UAS, GFP) plasmid
GTR15189730 1 Vial

Lentiviral mouse Ddx21 shRNA (UAS) - Lentiviral mouse Ddx21 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details