Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNPY4/PRAT4B, Human (HEK293, His)

CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CNPY4/PRAT4B Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cnpy4-prat4b-protein-human-hek293-his.html

Purity

93.80

Smiles

GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL

Molecular Formula

245812 (Gene_ID) Q8N129 (G22-L248) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECH1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0651708 1.0 µg DNA

ECH1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TMC2 (NM_080751) Human Tagged ORF Clone Lentiviral Particle
RC222491L4V 200 µL

TMC2 (NM_080751) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Agrostis stolonifera Photosystem II CP43 chlorophyll apoprotein (psbC), partial
MBS7063334 Inquire

Recombinant Agrostis stolonifera Photosystem II CP43 chlorophyll apoprotein (psbC), partial

Sign In for Pricing
View Details
anti-PREP
YF-PA27335 50 ug

anti-PREP

Sign In for Pricing
View Details
ARL14EP Knockout NCI-H1975 Polyclonal Cells
ARG31222 1 Million

ARL14EP Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Boc-D-Phe(3,4-DiF)-OH
5-04186 25 g

Boc-D-Phe(3,4-DiF)-OH

Sign In for Pricing
View Details