FGF-4, Human (153a.a)
The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (153a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
FGF-4 Protein, Human (153a.a), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-4-protein-human-153a-a.html
Purity
98.0
Smiles
SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Molecular Formula
2249 (Gene_ID) P08620-1 (S54-L206) (Accession)
Molecular Weight
Approximately 16.0 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDER100236-01 20 µg
Recombinant Rat CD22/Siglec-2 protein (His tag)
Sign In for Pricing
View Details PDER100236-02 100 µg
Recombinant Rat CD22/Siglec-2 protein (His tag)
Sign In for Pricing
View Details PDER100236-03 500 µg
Recombinant Rat CD22/Siglec-2 protein (His tag)
Sign In for Pricing
View Details 