Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-4, Human (153a.a)

The FGF-4 protein coordinates embryonic development, cell proliferation and differentiation and is critical for normal limb and heart valve development. FGF-4 may promote embryonic molar tooth bud development by inducing key gene expression. FGF-4 Protein, Human (153a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

FGF-4 Protein, Human (153a.a), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-4-protein-human-153a-a.html

Purity

98.0

Smiles

SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Molecular Formula

2249 (Gene_ID) P08620-1 (S54-L206) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AK3 knockdown cell line
ABC-KD0449 1 Vial

Human AK3 knockdown cell line

Sign In for Pricing
View Details
OPCA02770-500UG - Ptprn2 Recombinant Protein
OPCA02770-500UG 500 µg

OPCA02770-500UG - Ptprn2 Recombinant Protein

Sign In for Pricing
View Details
IGHA1 Antibody
E047254 100 µg -100 µL

IGHA1 Antibody

Sign In for Pricing
View Details
STAT3-IN-7
BA3158-5 5 mg

STAT3-IN-7

Sign In for Pricing
View Details
IGHVIII-26-1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1048203 1.0 µg DNA

IGHVIII-26-1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BPY2B Recombinant Protein (Human)
RP048691 100 µg

BPY2B Recombinant Protein (Human)

Sign In for Pricing
View Details