Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPARC, Human (HEK293, His)

SPARC proteins are essential for lipid transport and are involved in the production, transformation, and clearance of plasma lipoproteins. It interacts with different particles, shows a preference for HDL, and binds to cellular receptors such as LDLR and VLDLR to promote the uptake of APOE-containing lipoproteins. SPARC Protein, Human (HEK293, His) is the recombinant human-derived SPARC protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPARC Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sparc-protein-human-hek-293-his.html

Purity

98.0

Smiles

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Molecular Formula

6678 (Gene_ID) P09486 (A18-I303) (Accession)

Molecular Weight

Approximately 37-46 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb9b Mouse shRNA Plasmid (Locus ID 20706)
TR510310 1 Kit

Serpinb9b Mouse shRNA Plasmid (Locus ID 20706)

Sign In for Pricing
View Details
Indicator Sulfo Orange 0.4%
SO405 500 mL

Indicator Sulfo Orange 0.4%

Sign In for Pricing
View Details
Human Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit
orb778762-01 48 Tests

Human Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit

Sign In for Pricing
View Details
Human Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit
orb778762-02 96 Tests

Human Solute Carrier Family 30, Member 3 (SLC30A3) ELISA Kit

Sign In for Pricing
View Details
Histone H3 Rabbit mAb Antibody
orb3015342 100 µL

Histone H3 Rabbit mAb Antibody

Sign In for Pricing
View Details
ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (Azide free) (HRP)
MBS6366155-01 0.2 mL

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (Azide free) (HRP)

Sign In for Pricing
View Details