Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cystatin C/CST3, Rat (HEK293, His)

Cystatin C/CST3 protein is a vital regulator of cysteine proteinases, inhibiting enzymes like cathepsin B, H, and L to ensure proper enzyme activity.Its role as a local regulator underscores its significance in various biological processes.Cystatin C/CST3 Protein, Rat (HEK293, His) is the recombinant rat-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Cystatin C/CST3 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cystatin-c-protein-rat-hek293-his.html

Purity

95.00

Smiles

GTSRPPPRLLGAPQEADASEEGVQRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGINYYLDVEMGRTTCTKSQTNLTNCPFHDQPHLMRKALCSFQIYSVPWKGTHTLTKSSCKNA

Molecular Formula

25307 (Gene_ID) P14841 (G21-A140) (Accession)

Molecular Weight

16-25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNTG1 Protein Vector (Rat) (pPB-N-His)
PV307103 500 ng

SNTG1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human GAK sgRNA gene knockout kit - Lentiviral human GAK sgRNA gene knockout kit (100)
GTR15369931 1 Vial

Lentiviral human GAK sgRNA gene knockout kit - Lentiviral human GAK sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
TCR Vβ 4 Monoclonal Antibody
ANT-14663-100ug 100 µg

TCR Vβ 4 Monoclonal Antibody

Sign In for Pricing
View Details
TMED4 Antibody
OAGA04100-100UL 100 µL

TMED4 Antibody

Sign In for Pricing
View Details
HtrA1, NT (Serine Protease HTRA1, L56, Serine Protease 11, HTRA, PRSS11)
H7952-30A 200 µL

HtrA1, NT (Serine Protease HTRA1, L56, Serine Protease 11, HTRA, PRSS11)

Sign In for Pricing
View Details
LUZP2 Double Nickase Plasmid (h2)
sc-416485-NIC-2 20 µg

LUZP2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details