Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q tumor necrosis factor-related protein 3 (C1QTNF3)

Product Specifications

Product Name Alternative

Collagenous repeat-containing sequence 26 kDa protein (CORS26) (Secretory protein CORS26) (CTRP3)

Abbreviation

Recombinant Human C1QTNF3 protein

Gene Name

C1QTNF3

UniProt

Q9BXJ4

Expression Region

23-246aa

Organism

Homo sapiens (Human)

Target Sequence

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Metabolism

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.1 kDa

References & Citations

"Effects of the new C1q/TNF-related protein (CTRP-3) "cartonectin" on the adipocytic secretion of adipokines." Wolfing B., Buechler C., Weigert J., Neumeier M., Aslanidis C., Schoelmerich J., Schaffler A. Obesity (Silver Spring) 16:1481-1486 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI2 Overexpression Lysate (Native) - (Dry Ice)
NBP2-10366 0.1 mg

PADI2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit
MBS2705526-01 24 Strip Well

Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit
MBS2705526-02 48 Well

Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit
MBS2705526-03 96 Well

Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit
MBS2705526-04 5x 96 Well

Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit

Sign In for Pricing
View Details
Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit
MBS2705526-05 10x 96 Well

Human Alpha-1-B-Glycoprotein (a1BG) ELISA Kit

Sign In for Pricing
View Details