Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)

Product Specifications

Product Name Alternative

M; Matrix protein

Abbreviation

Recombinant Vesicular stomatitis Indiana virus Matrix protein

Gene Name

M

UniProt

P04876

Expression Region

1-237aa

Organism

Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)

Target Sequence

MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity) .

Molecular Weight

71.4 kDa

References & Citations

"Sequence alterations in temperature-sensitive M-protein mutants (complementation group III) of vesicular stomatitis virus." Gopalakrishna Y., Lenard J. J. Virol. 56:655-659 (1985)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCS antibody
FNab01395 100 µg

CCS antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561130 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
TBCC Antibody
C49170-01 50 μL

TBCC Antibody

Sign In for Pricing
View Details
TBCC Antibody
C49170-02 100 µL

TBCC Antibody

Sign In for Pricing
View Details
Anti-PHF1 Antibody
CPA4962-01 30 µL

Anti-PHF1 Antibody

Sign In for Pricing
View Details
Anti-PHF1 Antibody
CPA4962-02 50 μL

Anti-PHF1 Antibody

Sign In for Pricing
View Details