Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Product Specifications

Product Name Alternative

MHC class I antigen E (HLA-6.2) (HLAE)

Abbreviation

Recombinant Human HLA-E protein, partial

Gene Name

HLA-E

UniProt

P13747

Expression Region

22-305aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Molecular Weight

36.7 kDa

References & Citations

"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM22 Antibody
19-706 100 µL

TRIM22 Antibody

Sign In for Pricing
View Details
SLFN12, ID (SLFN12, Schlafen family member 12) (MaxLight 650)
MBS6348624-01 0.1 mL

SLFN12, ID (SLFN12, Schlafen family member 12) (MaxLight 650)

Sign In for Pricing
View Details
SLFN12, ID (SLFN12, Schlafen family member 12) (MaxLight 650)
MBS6348624-02 5x 0.1 mL

SLFN12, ID (SLFN12, Schlafen family member 12) (MaxLight 650)

Sign In for Pricing
View Details
Mri1 antibody - N-terminal region (ARP37364_T100)
ARP37364_T100 100 µL

Mri1 antibody - N-terminal region (ARP37364_T100)

Sign In for Pricing
View Details
EPRS Antibody, FITC conjugated
A20765-50UG 50 µg

EPRS Antibody, FITC conjugated

Sign In for Pricing
View Details
SOX9 Antibody : FITC (OABF01413-FITC)
OABF01413-FITC 100 µL

SOX9 Antibody : FITC (OABF01413-FITC)

Sign In for Pricing
View Details