Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, alpha chain E (HLA-E), partial

Product Specifications

Product Name Alternative

MHC class I antigen E (HLA-6.2) (HLAE)

Abbreviation

Recombinant Human HLA-E protein, partial

Gene Name

HLA-E

UniProt

P13747

Expression Region

22-305aa

Organism

Homo sapiens (Human)

Target Sequence

GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Preferably binds to a peptide derived from the signal sequence of most HLA-A, -B, -C and -G molecules.

Molecular Weight

36.7 kDa

References & Citations

"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins." Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D. Nat. Biotechnol. 27:378-386 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5MC2 (NM_001002031) Human Tagged ORF Clone
RC222476 10 µg

ATP5MC2 (NM_001002031) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-DZIP1 Antibody Picoband® FITC Conjugated
A07906-1-FITC 100 µg/Vial

Anti-DZIP1 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
PE/XFD700 Anti-human CD243 Antibody *UIC2*
124301Q0-AAT 25 Tests

PE/XFD700 Anti-human CD243 Antibody *UIC2*

Sign In for Pricing
View Details
Rabbit Polyclonal Adenine Nucleotide Translocator 2 Antibody
NBP2-92630-0.02mL 0.02 mL

Rabbit Polyclonal Adenine Nucleotide Translocator 2 Antibody

Sign In for Pricing
View Details
Homeobox protein OTX2 (OTX2) Rat ELISA Kit
E1137 96 Tests

Homeobox protein OTX2 (OTX2) Rat ELISA Kit

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Beta-glucosidase 20 (BGLU20)
MBS1063899-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Beta-glucosidase 20 (BGLU20)

Sign In for Pricing
View Details