Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G), partial

Product Specifications

Product Name Alternative

Attachment glycoprotein GMembrane-bound glycoprotein (mG)

Abbreviation

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G, partial

Gene Name

G

UniProt

P03423

Expression Region

67-298aa

Organism

Human respiratory syncytial virus A (strain A2)

Target Sequence

HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Attaches the virion to the host cell mbrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hagglutinating activities.Secreted glycoprotein G helps RSV escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fcgamma receptors.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.; FUNCTION

Molecular Weight

29.3 kDa

References & Citations

The RSV F and G glycoproteins interact to form a complex on the surface of infected cells.Low K.W., Tan T., Ng K., Tan B.H., Sugrue R.J.Biochem. Biophys. Res. Commun. 366:308-313 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Vmn1r121 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49539154 3x 1.0 µg DNA

Vmn1r121 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Ask
View Details
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells
MBS9420192-01 0.02 mg

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells

Ask
View Details
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells
MBS9420192-02 0.1 mg

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells

Ask
View Details
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells
MBS9420192-03 1 mg

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells

Ask
View Details
Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells
MBS9420192-04 5x 1 mg

Recombinant Human Receptor-binding cancer antigen expressed on SiSo cells

Ask
View Details
Anti-C.CRP antibody
10-2798 500 ug

Anti-C.CRP antibody

Ask
View Details