Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial

Product Specifications

Product Name Alternative

TMEM168; Transmembrane protein 168

Abbreviation

Recombinant Pongo abelii TMEM168 protein, partial

Gene Name

TMEM168

UniProt

Q5RD28

Expression Region

527-637aa

Organism

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Target Sequence

EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.8 kDa

References & Citations

The German cDNA consortium Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC45A1 Human Gene Knockout Kit (CRISPR)
KN424641 1 Kit

SLC45A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Neutravidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB21F4-NA/W 10x 96 Well Plates

Neutravidin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E1]
TA804136BM 100 µL

PRAK (MAPKAPK5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E1]

Sign In for Pricing
View Details
IRF-3 (Ab-386) Antibody
8B8203-AAT 50 µg

IRF-3 (Ab-386) Antibody

Sign In for Pricing
View Details
CD74 (LN-2), CF640R conjugate, 0.1mg/mL
BNC400056-500 1x 500 µL

CD74 (LN-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Txndc2 Mouse Gene Knockout Kit (CRISPR)
KN518513 1 Kit

Txndc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details