Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial

Product Specifications

Product Name Alternative

TMEM168; Transmembrane protein 168

Abbreviation

Recombinant Pongo abelii TMEM168 protein, partial

Gene Name

TMEM168

UniProt

Q5RD28

Expression Region

527-637aa

Organism

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Target Sequence

EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.8 kDa

References & Citations

The German cDNA consortium Submitted (NOV-2004) to the EMBL/GenBank/DDBJ databases

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTH1 (NUDT1) (NM_198950) Human Recombinant Protein
TP312761 20 µg

MTH1 (NUDT1) (NM_198950) Human Recombinant Protein

Sign In for Pricing
View Details
RASGRP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C11]
TA801533BM 100 µL

RASGRP3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details
PTP4A2 Human qPCR Primer Pair (NM_080391)
HP229679 200 Reactions

PTP4A2 Human qPCR Primer Pair (NM_080391)

Sign In for Pricing
View Details
Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit
E-EL-H1587-01 24 Tests

Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit

Sign In for Pricing
View Details
Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit
E-EL-H1587-02 48 Tests

Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit

Sign In for Pricing
View Details
Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit
E-EL-H1587-03 96 Tests

Human TGF-β2 (Transforming Growth Factor Beta 2) ELISA Kit

Sign In for Pricing
View Details