Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial

Product Specifications

Product Name Alternative

ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2

Abbreviation

Recombinant Human CHRNA3 protein, partial

Gene Name

CHRNA3

UniProt

P32297

Expression Region

32-240aa

Organism

Homo sapiens (Human)

Target Sequence

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Molecular Weight

26.6 kDa

References & Citations

"Structure of the Bordetella pertussis gene coding for the serotype 3 fimbrial subunit." Mooi F.R., Ter Avest A., van der Heide H.G.J. FEMS Microbiol. Lett. 54:327-331 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRRG2 Protein Vector (Mouse) (pPM-C-HA)
37817024 500 ng

PRRG2 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
RGS19 (S24) (Regulator of G-protein signaling 19, RGS19, G-alpha interacting protein, GAIP protein, GS19, GAIP, GNAI3IP) (Biotin) discontinued
041008-Biotin 200 µL

RGS19 (S24) (Regulator of G-protein signaling 19, RGS19, G-alpha interacting protein, GAIP protein, GS19, GAIP, GNAI3IP) (Biotin) discontinued

Ask
View Details
Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)
MBS1150045-01 0.02 mg (E-Coli)

Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)

Ask
View Details
Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)
MBS1150045-02 0.1 mg (E-Coli)

Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)

Ask
View Details
Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)
MBS1150045-03 0.02 mg (Yeast)

Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)

Ask
View Details
Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)
MBS1150045-04 0.1 mg (Yeast)

Recombinant Saccharopolyspora erythraea NADH-quinone oxidoreductase subunit C (nuoC)

Ask
View Details