Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR)

Product Specifications

Product Name Alternative

Protein B5

Abbreviation

Recombinant Vaccinia virus PS/HR protein

Gene Name

PS/HR

UniProt

P24284

Expression Region

18-92aa

Organism

Vaccinia virus (strain LC16m8) (VACV)

Target Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Tag

N-terminal MBP-tagged and C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Molecular Weight

52.6 kDa

References & Citations

"Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins." Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M. Virology 181:158-164 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV704525 1.0 µg DNA

PTPN23 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
SPCA2 (ATP2C2) (NM_014861) Human Over-expression Lysate
LS009914-20ug 20 µg

SPCA2 (ATP2C2) (NM_014861) Human Over-expression Lysate

Sign In for Pricing
View Details
CYP17A1 ELISA Kit (Mouse) (OKEH06931)
OKEH06931 96 Well

CYP17A1 ELISA Kit (Mouse) (OKEH06931)

Sign In for Pricing
View Details
Estrogen Receptor alpha Rabbit mAb, 1 pack = 50 µL
BAL5204 1 Each

Estrogen Receptor alpha Rabbit mAb, 1 pack = 50 µL

Sign In for Pricing
View Details
SERPINB3 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-43190M-BF680 100 µL

SERPINB3 Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial
MBS1113694-01 1 mg (E-Coli)

Recombinant Marchantia polymorpha Photosystem I reaction center subunit VIII (psaI), partial

Sign In for Pricing
View Details