Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tenascin (Tnc), partial

Product Specifications

Product Name Alternative

Hexabrachion Tenascin-C Short name: TN-C Hxb

Abbreviation

Recombinant Mouse Tnc protein, partial

Gene Name

Tnc

UniProt

Q80YX1

Expression Region

1884-2099aa

Organism

Mus musculus (Mouse)

Target Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3 and ITGAV:ITGB6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth when provided to neurons in culture. May play a role in supporting the growth of epithelial tumors. Ligand for integrins ITGA8

Molecular Weight

28.8 kDa

References & Citations

"Murine tenascin-W: a novel mammalian tenascin expressed in kidney and at sites of bone and smooth muscle development." Scherberich A., Tucker R.P., Samandari E., Brown-Luedi M., Martin D., Chiquet-Ehrismann R. J. Cell Sci. 117:571-581 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREX2 Antibody
254002 0.1 mg

TREX2 Antibody

Sign In for Pricing
View Details
OLA1, NT (OLA1, GTPBP9, Obg-like ATPase 1, GTP-binding protein 9) (PE)
MBS6327688-01 0.2 mL

OLA1, NT (OLA1, GTPBP9, Obg-like ATPase 1, GTP-binding protein 9) (PE)

Sign In for Pricing
View Details
OLA1, NT (OLA1, GTPBP9, Obg-like ATPase 1, GTP-binding protein 9) (PE)
MBS6327688-02 5x 0.2 mL

OLA1, NT (OLA1, GTPBP9, Obg-like ATPase 1, GTP-binding protein 9) (PE)

Sign In for Pricing
View Details
ROMO1 Antibody, FITC conjugated
A33483-50UG 50 µg

ROMO1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PE anti-human ZAP70 Phospho (Tyr493)
GT16580 100 Tests

PE anti-human ZAP70 Phospho (Tyr493)

Sign In for Pricing
View Details
(+) -Quinolactacin A1
orb1737744-01 25 mg

(+) -Quinolactacin A1

Sign In for Pricing
View Details