Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sushi repeat-containing protein SRPX2 (Srpx2)

Product Specifications

Product Name Alternative

Srpx2Sushi repeat-containing protein SRPX2

Abbreviation

Recombinant Mouse Srpx2 protein

Gene Name

Srpx2

UniProt

Q8R054

Expression Region

26-468aa

Organism

Mus musculus (Mouse)

Target Sequence

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Neuroscience

Relevance

Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords) . Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords) . Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations.

Molecular Weight

54.5 kDa

References & Citations

"Cloning and characterization of the sushi-repeat containing protein (SRP) as a novel interaction partner of Rh type C glycoprotein (RhCG) ." Huang C.-H., Chen H., Peng J., Chen Y. Submitted (JUN-2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1H,1H,2H,2H-Perfluorohexyl iodide
TRC-P286370-1G 1 g

1H,1H,2H,2H-Perfluorohexyl iodide

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS704377 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]
E-AB-F1413J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]
E-AB-F1413J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]
E-AB-F1413J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD47 Antibody[B6H12]

Sign In for Pricing
View Details
p-Coumaroylagmatine-D₈
TRC-C979471-10MG 10 mg

p-Coumaroylagmatine-D₈

Sign In for Pricing
View Details