Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gasdermin-C (GSDMC)

Product Specifications

Product Name Alternative

Melanoma-derived leucine zipper-containing extranuclear factor

Abbreviation

Recombinant Human GSDMC protein

Gene Name

GSDMC

UniProt

Q9BYG8

Expression Region

1-508aa

Organism

Homo sapiens (Human)

Target Sequence

MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRMELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cancer

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The N-terminal moiety promotes pyroptosis. May be acting by homooligomerizing within the membrane and forming pores

Molecular Weight

61.7 kDa

References & Citations

"Structure, expression and chromosome mapping of MLZE, a novel gene which is preferentially expressed in metastatic melanoma cells." Watabe K., Ito A., Asada H., Endo Y., Kobayashi T., Nakamoto K., Itami S., Takao S., Shinomura Y., Aikou T., Yoshikawa K., Matsuzawa Y., Kitamura Y., Nojima H.Jpn. J. Cancer Res. 92:140-151 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Superoxide Dismutase Microplate Assay Kit
RDSM010 100 Assays

Superoxide Dismutase Microplate Assay Kit

Sign In for Pricing
View Details
Mogamulizumab Biosimilar - Research Grade
ICH5186-50mg 50 mg

Mogamulizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CASP2 (p18, Cleaved-Thr325) Antibody
8L0152-AAT 50 µg

CASP2 (p18, Cleaved-Thr325) Antibody

Sign In for Pricing
View Details
RGS2 (NM_002923) Human Over-expression Lysate
LY401021 100 µg

RGS2 (NM_002923) Human Over-expression Lysate

Sign In for Pricing
View Details
SULt1a1 Mouse Gene Knockout Kit (CRISPR)
KN516960 1 Kit

SULt1a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EXOSC1 Antibody
KC-28550-01 50 μL

EXOSC1 Antibody

Sign In for Pricing
View Details