Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA)

Product Specifications

Product Name Alternative

Pfr

Abbreviation

Recombinant Helicobacter pylori ftnA protein

Gene Name

FtnA

UniProt

P52093

Expression Region

1-167aa

Organism

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Target Sequence

MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Iron-storage protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Iron-storage protein.

Molecular Weight

21.8 kDa

References & Citations

"Paracrystalline inclusions of a novel ferritin containing nonheme iron, produced by the human gastric pathogen Helicobacter pylori: evidence for a third class of ferritins." Frazier B.A., Pfeifer J.D., Russell D.G., Falk P., Olsen A.N., Hammar M., Westblom T.U., Normark S.J. J. Bacteriol. 175:966-972 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA19-9 Monoclonal Antibody
VAnt-Wyb744 Each

CA19-9 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal p190RhoGAP Antibody (4D4-F8)
H00002909-M01 0.1 mg

Mouse Monoclonal p190RhoGAP Antibody (4D4-F8)

Sign In for Pricing
View Details
Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit
MBS9367609-01 48 Well

Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit

Sign In for Pricing
View Details
Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit
MBS9367609-02 96 Well

Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit

Sign In for Pricing
View Details
Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit
MBS9367609-03 5x 96 Well

Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit

Sign In for Pricing
View Details
Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit
MBS9367609-04 10x 96 Well

Hamster Troponin I Type 1, Slow Skeletal (TNNI1) ELISA Kit

Sign In for Pricing
View Details