Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C1q subcomponent subunit A (C1QA)

Product Specifications

Product Name Alternative

C1qa; C1QA_HUMAN; Complement C1q subcomponent subunit A; Complement component 1 q subcomponent A chain; Complement component 1 q subcomponent alpha polypeptide; Complement component C1q A chain

Abbreviation

Recombinant Human C1QA protein

Gene Name

C1QA

UniProt

P02745

Expression Region

23-245aa

Organism

Homo sapiens (Human)

Target Sequence

EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca (2+) -dependent C1r (2) C1s (2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

Molecular Weight

27.7 kDa

References & Citations

"Completion of the amino acid sequences of the A and B chains of subcomponent C1q of the first component of human complement." Reid K.B.M., Gagnon J., Frampton J. Biochem. J. 203:559-569 (1982)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rictor CRISPR Activation Plasmid (m2)
sc-429705-ACT-2 20 µg

Rictor CRISPR Activation Plasmid (m2)

Ask
View Details
Mouse Monoclonal PDX-1/IPF1 Antibody (PCRP-PDX1-2C11) [PE]
NBP3-08853PE 100 µL

Mouse Monoclonal PDX-1/IPF1 Antibody (PCRP-PDX1-2C11) [PE]

Ask
View Details
Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)
MBS1414654-01 0.02 mg (E-Coli)

Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)

Ask
View Details
Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)
MBS1414654-02 0.02 mg (Yeast)

Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)

Ask
View Details
Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)
MBS1414654-03 0.1 mg (E-Coli)

Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)

Ask
View Details
Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)
MBS1414654-04 0.1 mg (Yeast)

Recombinant Myxococcus xanthus Elongation factor Tu 2 (tuf2)

Ask
View Details